PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000192051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 251aa    MW: 28825.5 Da    PI: 8.4804
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000192051genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-16550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd+ll ++++q+G g W++ +   g++R++k+c++rw++yl
    MDP0000192051  5 PWTKEEDQLLRKCIEQHGEGKWHRLPLLAGLNRCRKSCRLRWLNYL 50
                     7*******************************************97 PP

2Myb_DNA-binding49.41.1e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ +eE +l+++++++lG++ W+++a++++ gRt++++k++w+ +
    MDP0000192051  56 RGNFEEEEVDLIIKLHRLLGNR-WSSVAARLP-GRTGNDVKNYWNCH 100
                      89********************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.875150IPR017930Myb domain
SMARTSM007173.9E-13252IPR001005SANT/Myb domain
SuperFamilySSF466894.77E-27497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-22557IPR009057Homeodomain-like
CDDcd001671.85E-11550No hitNo description
PfamPF002499.7E-15550IPR001005SANT/Myb domain
PROSITE profilePS5129424.96451105IPR017930Myb domain
SMARTSM007174.7E-1555103IPR001005SANT/Myb domain
PfamPF002492.3E-145698IPR001005SANT/Myb domain
CDDcd001672.85E-1058101No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2458105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGGIPWTKEE DQLLRKCIEQ HGEGKWHRLP LLAGLNRCRK SCRLRWLNYL RPNIKRGNFE  60
EEEVDLIIKL HRLLGNRWSS VAARLPGRTG NDVKNYWNCH LSKRLNAQQD HQSEYHIKNK  120
HDAVRNINNG VKVIRSQASN SAGTSSSKRP SYAPTPHQPV NVFVQEEGSS TGPKPKLCNF  180
NGNGQNNNQI FENNNNNSTG INASDYPMDD XLPPFDQQVK EYHQGGDDGD QVNRKWEWDX  240
SIFADMDLWT D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2251079110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1592321e-125KT159232.1 Prunus persica R2R3-MYB transcription factor (MYB9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338015.11e-162PREDICTED: myb-related protein 308-like
TrEMBLM5W0N91e-87M5W0N9_PRUPE; R2R3-MYB transcription factor
STRINGGLYMA18G41520.15e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-51myb domain protein 113